PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof011439
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 238aa    MW: 25376.9 Da    PI: 8.2861
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-23451PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.6e-1469113347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G g+W+ I+r + + Rt+ q+ s+ qky
        Sof011439  69 PWTEEEHKLFLMGLKKYGRGDWRNISRNFVTSRTPTQVASHAQKY 113
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.36462118IPR017930Myb domain
SuperFamilySSF466891.08E-1764118IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-1765116IPR006447Myb domain, plants
SMARTSM007175.3E-1266116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-1267112IPR009057Homeodomain-like
CDDcd001676.92E-1269114No hitNo description
PfamPF002498.6E-1269113IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
XGFIEAGFVP FPHYGGGGGG PSQSAGFTFD WDGSGGDAGA LGAFKRSCYV VGGGKRERGP  60
DHERKKGIPW TEEEHKLFLM GLKKYGRGDW RNISRNFVTS RTPTQVASHA QKYFIRLNSG  120
GKDKRRSSIH DITTVNLPDD DAGGGNNPSA SPPSVLTSTS TPSSTGGGGG QVISEQFGVL  180
VDSQPPPPPP HHHHHFLPHS YGNVKLEPGV NSYHGAGFLD DSVLMQMQMH CGQLQPLG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001146624.11e-126MYB transcription factor
SwissprotQ8S9H74e-53DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB7ZY891e-126B7ZY89_MAIZE; MYB transcription factor
STRINGGRMZM2G002128_P011e-126(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.15e-49MYB family protein